PDB entry 2puu

View 2puu on RCSB PDB site
Description: Crystal structure of p38 complex with 1-(5-tert-Butyl-2-p-tolyl-2H-pyrazol-3-yl)-3-[4-(6-morpholin-4-ylmethyl-pyridin-3-yl)naphthalen-1-yl]urea
Class: transferase
Keywords: p38alpha, MAP kinases, crystal structure, drug discovery, TRANSFERASE
Deposited on 2007-05-09, released 2008-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: MUS MUSCULUS
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47811 (0-347)
      • engineered (9)
      • conflict (115)
    Domains in SCOPe 2.06: d2puua_
  • Heterogens: G2G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2puuA (A:)
    rptfyrqelaktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcakltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyva
    trwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpga
    ellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqala
    hayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2puuA (A:)
    rptfyrqelaktiwevperyqnlspvsvcaafdtktghrvavkklsrpfqsiihakrtyr
    elrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcakltddhvqfl
    iyqilrglkyihsadiihrdlkpsnlavnedcelkildfgvatrwyrapeimlnwmhynq
    tvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsl
    aqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadp
    ydqsfesrdllidewksltydevisfvppp