PDB entry 2puo

View 2puo on RCSB PDB site
Description: Crystal srtucture of the NEM modified ferredoxin:thioredoxin reductase
Class: electron transport
Keywords: Thioredoxin, redox, iron-sulfur, ELECTRON TRANSPORT
Deposited on 2007-05-09, released 2007-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ferredoxin-thioredoxin reductase, catalytic chain
  Species: Synechocystis sp. [TaxId:1143]
  Gene: ftrC
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q55389 (0-108)
  Domains in SCOPe 2.08: d2puoa_
• Chain 'B':
  Compound: Ferredoxin-thioredoxin reductase, variable chain
  Species: Synechocystis sp. [TaxId:1143]
  Gene: ftrV
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q55781 (0-72)
  Domains in SCOPe 2.08: d2puob_
• Heterogens: SO4, SF4, NEQ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2puoA (A:)
  nnktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeae
  vkntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2puoB (B:)
  mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
  fkahfrpdevtli