PDB entry 2puk

View 2puk on RCSB PDB site
Description: Crystal structure of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin m
Class: electron transport
Keywords: Thioredoxin, protein-protein complex, redox, iron-sulfur, ELECTRON TRANSPORT
Deposited on 2007-05-09, released 2007-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-thioredoxin reductase, catalytic chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2puka_
  • Chain 'B':
    Compound: Ferredoxin-thioredoxin reductase, variable chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pukb_
  • Chain 'C':
    Compound: Thioredoxin M-type, chloroplast (TRX-M)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07591 (0-105)
      • engineered (32)
    Domains in SCOPe 2.07: d2pukc_
  • Chain 'E':
    Compound: Ferredoxin-thioredoxin reductase, catalytic chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55389 (1-108)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d2puke2, d2puke3
  • Chain 'F':
    Compound: Ferredoxin-thioredoxin reductase, variable chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pukf_
  • Chain 'G':
    Compound: Thioredoxin M-type, chloroplast (TRX-M)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07591 (0-End)
      • engineered (32)
    Domains in SCOPe 2.07: d2pukg_
  • Heterogens: SF4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pukA (A:)
    nnktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeae
    vkntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pukA (A:)
    nktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev
    kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pukB (B:)
    mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
    fkahfrpdevtli
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pukC (C:)
    evqdvndsswkefvlesevpvmvdfwapwcgpskliapvidelakeysgkiavyklntde
    apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyls
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pukE (E:)
    nnktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeae
    vkntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkas
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pukF (F:)
    mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
    fkahfrpdevtli
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2pukG (G:)
    evqdvndsswkefvlesevpvmvdfwapwcgpskliapvidelakeysgkiavyklntde
    apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pukG (G:)
    evqdvndsswkefvlesevpvmvdfwapwcgpskliapvidelakeysgkiavyklntde
    apgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl