PDB entry 2pud

View 2pud on RCSB PDB site
Description: crystal structure of the laci family member, purr, bound to DNA: minor groove binding by alpha helices
Class: transcription/DNA
Keywords: complex (DNA-binding protein/DNA), DNA-binding regulatory protein, transcription/DNA complex
Deposited on 1997-10-04, released 1998-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.177
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (purine repressor)
    Species: Escherichia coli [TaxId:562]
    Gene: PURR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ACP7
      • engineered (188)
    Domains in SCOPe 2.07: d2puda1, d2puda2
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*cp*gp*cp*ap*ap*ap*cp*gp*tp*tp*tp*gp*cp*gp*t )-3')
  • Heterogens: HPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pudA (A:)
    atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
    igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
    mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
    gvipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
    avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
    fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pudA (A:)
    tikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtksi
    gllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvm
    cseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghreig
    vipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpta
    vfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetaf
    nmlldrivnkreepqsievhprlierrsvadgpfrdyr
    

  • Chain 'B':
    No sequence available.