PDB entry 2pu9

View 2pu9 on RCSB PDB site
Description: Crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
Class: electron transport
Keywords: Thioredoxin, protein-protein complex, redox, iron-sulfur, ELECTRON TRANSPORT
Deposited on 2007-05-09, released 2007-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-thioredoxin reductase, catalytic chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pu9a_
  • Chain 'B':
    Compound: Ferredoxin-thioredoxin reductase, variable chain
    Species: Synechocystis sp. [TaxId:1143]
    Gene: ftrV
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pu9b_
  • Chain 'C':
    Compound: Thioredoxin F-type, chloroplast
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09856 (0-110)
      • engineered (38)
    Domains in SCOPe 2.08: d2pu9c_
  • Heterogens: SO4, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pu9A (A:)
    nktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev
    kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkasma
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pu9B (B:)
    mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
    fkahfrpdevtlie
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pu9C (C:)
    eaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpskamapkyeklaeeyldviflk
    ldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars