PDB entry 2pu9
View 2pu9 on RCSB PDB site
Description: Crystal srtucture of the binary complex between ferredoxin: thioredoxin reductase and thioredoxin f
Class: electron transport
Keywords: Thioredoxin, protein-protein complex, redox, iron-sulfur, ELECTRON TRANSPORT
Deposited on
2007-05-09, released
2007-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-18, with a file datestamp of
2017-10-13.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Ferredoxin-thioredoxin reductase, catalytic chain
Species: Synechocystis sp. [TaxId:1143]
Gene: ftrC
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2pu9a_ - Chain 'B':
Compound: Ferredoxin-thioredoxin reductase, variable chain
Species: Synechocystis sp. [TaxId:1143]
Gene: ftrV
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2pu9b_ - Chain 'C':
Compound: Thioredoxin F-type, chloroplast
Species: Spinacia oleracea [TaxId:3562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2pu9c_ - Heterogens: SO4, SF4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2pu9A (A:)
nktlaamknfaeqyakrtdtyfcsdlsvtavvieglarhkeelgsplcpcrhyedkeaev
kntfwncpcvpmrerkechcmlfltpdndfagdaqdipmetleevkasma
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2pu9B (B:)
mnvgdrvrvtssvvvyhhpehkktafdlqgmegevaavltewqgrpisanlpvlvkfeqr
fkahfrpdevtlie
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>2pu9C (C:)
eaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpskamapkyeklaeeyldviflk
ldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars