PDB entry 2ptm

View 2ptm on RCSB PDB site
Description: Structure and rearrangements in the carboxy-terminal region of SpIH channels
Class: transport protein
Keywords: ion channel, cyclic nucleotide binding domain, C-linker, cAMP, cGMP, spHCN1, HCN, TRANSPORT PROTEIN
Deposited on 2007-05-08, released 2007-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hyperpolarization-activated (Ih) channel
    Species: Strongylocentrotus purpuratus [TaxId:7668]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ptma_
  • Heterogens: NCO, CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ptmA (A:)
    gamdsssrqyreklkqveeymqyrklpshlrnkildyyeyryrgkmfderhifrevsesi
    rqdvanyncrdlvasvpffvgadsnfvtrvvtllefevfqpadyviqegtfgdrmffiqq
    givdiimsdgviatslsdgsyfgeiclltrerrvasvkcetyctlfslsvqhfnqvldef
    pamrktmeeiavrrltri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ptmA (A:)
    dsssrqyreklkqveeymqyrklpshlrnkildyyeyryrgkmfderhifrevsesirqd
    vanyncrdlvasvpffvgadsnfvtrvvtllefevfqpadyviqegtfgdrmffiqqgiv
    diimsdgviatslsdgsyfgeiclltrerrvasvkcetyctlfslsvqhfnqvldefpam
    rktmeeiavrrl