PDB entry 2ptl

View 2ptl on RCSB PDB site
Description: three-dimensional solution structure of an immunoglobulin light chain-binding domain of protein l. comparison with the igg-binding domains of protein g
Class: binding protein(immunoglobulin l chain)
Keywords: binding protein(immunoglobulin l chain)
Deposited on 1994-08-12, released 1994-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein l
    Species: Finegoldia magna [TaxId:334413]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ptla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ptlA (A:)
    enkeetpetpetdseeevtikanlifangstqtaefkgtfekatseayayadtlkkdnge
    ytvdvadkgytlnikfag