PDB entry 2ptj

View 2ptj on RCSB PDB site
Description: Crystal Structure of F169R p38 Kinase
Class: signaling protein,transferase
Keywords: Protein Kinase, SIGNALING PROTEIN,TRANSFERASE
Deposited on 2007-05-08, released 2007-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-04-21, with a file datestamp of 2010-04-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.254
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • engineered (168)
    Domains in SCOPe 2.06: d2ptja_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ptjA (A:)
    msqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfq
    siihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcq
    kltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildrglarhtddemt
    gyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvg
    tpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaa
    qalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ptjA (A:)
    rptfyrqelnktiwevperyqnlspvgsygsvcaafdtktglrvavkklsrpfqsiihak
    rtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddh
    vqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildrglatrwyrapeimlnwm
    hynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarny
    iqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddep
    vadpydqsfesrdllidewksltydevisfvppp