PDB entry 2ptg

View 2ptg on RCSB PDB site
Description: Crystal structure of Eimeria tenella enoyl reductase
Class: oxidoreductase
Keywords: Apicomplexa, Eimeria, Eimeria tenella, enoyl (acyl-carrier-protein) reductase, OXIDOREDUCTASE
Deposited on 2007-05-08, released 2007-09-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier reductase
    Species: Eimeria tenella [TaxId:413949]
    Gene: ENR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ptga_
  • Chain 'B':
    Compound: enoyl-acyl carrier reductase
    Species: Eimeria tenella [TaxId:413949]
    Gene: ENR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2ptgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ptgA (A:)
    gplpvdlrgktafvagvadsngygwaickllraagarvlvgtwppvysifkkglessrfe
    qdsfyaqepsskvaaeaaekpvdlvfdkiypldavfdtpqdvppevssnkryagvggfti
    sevaeavradvgqidilvhslangpevtkpllqtsrkgylaavssssysfvsllqhflpl
    mkeggsalalsyiasekvipgygggmssakaalesdcrtlafeagraravrvncisagpl
    ksraasaigkagdktfidlaidyseanaplqkelesddvgraalfllsplaravtgatly
    vdnglhamgqaldsksltp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ptgA (A:)
    plpvdlrgktafvagvadsngygwaickllraagarvlvgtwppvysifkkvfdkiypld
    avfdtpqdvppevssnyagvggftisevaeavradvgqidilvhslangpevtkpllqts
    rkgylaavssssysfvsllqhflplmkeggsalalsyialesdcrtlafeagraravrvn
    cisagplkelesddvgraalfllsplaravtgatlyvdnglham
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ptgB (B:)
    gplpvdlrgktafvagvadsngygwaickllraagarvlvgtwppvysifkkglessrfe
    qdsfyaqepsskvaaeaaekpvdlvfdkiypldavfdtpqdvppevssnkryagvggfti
    sevaeavradvgqidilvhslangpevtkpllqtsrkgylaavssssysfvsllqhflpl
    mkeggsalalsyiasekvipgygggmssakaalesdcrtlafeagraravrvncisagpl
    ksraasaigkagdktfidlaidyseanaplqkelesddvgraalfllsplaravtgatly
    vdnglhamgqaldsksltp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ptgB (B:)
    plpvdlrgktafvagvadsngygwaickllraagarvlvgtwppvysifkkvfdkiypld
    avfdtpqdvppevssnyagvggftisevaeavradvgqidilvhslangpevtkpllqts
    rkgylaavssssysfvsllqhflplmkeggsalalsyialesdcrtlafeagraravrvn
    cisagplkelesddvgraalfllsplaravtgatlyvdnglham