PDB entry 2ptd

View 2ptd on RCSB PDB site
Description: phosphatidylinositol-specific phospholipase c mutant d198e
Deposited on 1997-07-16, released 1998-01-21
The last revision prior to the SCOP 1.67 freeze date was dated 1998-01-21, with a file datestamp of 1998-01-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d2ptd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >2ptd_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqekykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqevirankslike
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ptd_ (-)
    assvnelenwskwmqpipdsiplarisipgthdsgtfklqnpikqvwgmtqeydfryqmd
    hgarifdirgrltddntivlhhgplylyvtlhefineakqflkdnpsetiimslkkeyed
    mkgaedsfsstfekkyfvdpiflktegniklgdargkivllkrysgsnepggynnfywpd
    netftttvnqnanvtvqekykvsydekvksikdtmdetmnnsedlnhlyinftslssggt
    awnspyyyasyinpeianyikqknparvgwviqdyinekwspllyqeviranksli