PDB entry 2psv

View 2psv on RCSB PDB site
Description: Crystal Structure of wild type HIV-1 protease in complex with CARB-KB45
Class: hydrolase
Keywords: Drug design, HIV-1 protease, Protease inhibitors, HYDROLASE
Deposited on 2007-05-07, released 2007-06-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.167
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38732 (0-98)
    • engineered (6)
  Domains in SCOPe 2.02: d2psva_
• Chain 'B':
  Compound: Protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot O38732 (0-98)
    • engineered (6)
  Domains in SCOPe 2.02: d2psvb_
• Heterogens: PO4, ACT, MUV, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2psvA (A:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2psvB (B:)
  pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf