SCOPe 2.01: Structural Classification of Proteins

PDB entry 2psr

View 2psr on RCSB PDB site
Description: human psoriasin (s100a7) ca2+ and zn2+ bound form (crystal form II)
Class: ef-hand protein
Keywords: ca-binding, zn-binding, psoriasis, s100 protein family, ef-hand protein
Deposited on 1998-09-17, released 1999-06-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.216
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: psoriasin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P31151 (0-End)
Domains in SCOPe 2.01: d2psra_
Heterogens: CA, ZN, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2psrA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcsggsq

Sequence, based on observed residues (ATOM records): (download)

>2psrA (A:)
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnyladvfek
kdknedkkidfseflsllgdiatdyhkqshgaapcs