PDB entry 2pso

View 2pso on RCSB PDB site
Description: Human StarD13 (DLC2) lipid transfer and protein localization domain
Class: structural genomics, unknown function
Keywords: alpha and beta protein, lipid binding, helix swapping, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2007-05-07, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: StAR-related lipid transfer protein 13
    Species: Homo sapiens [TaxId:9606]
    Gene: STARD13, DLC2, GT650
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psoa1
  • Chain 'B':
    Compound: StAR-related lipid transfer protein 13
    Species: Homo sapiens [TaxId:9606]
    Gene: STARD13, DLC2, GT650
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psob_
  • Chain 'C':
    Compound: StAR-related lipid transfer protein 13
    Species: Homo sapiens [TaxId:9606]
    Gene: STARD13, DLC2, GT650
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2psoc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2psoA (A:)
    mhhhhhhssgvdlgtenlyfqsmeesgatfhtylnhliqglqkeakekfkgwvtcsstdn
    tdlafkkvgdgnplklwkasveveappsvvlnrvlrerhlwdedfvqwkvvetldrqtei
    yqyvlnsmaphpsrdfvvlrtwktdlpkgmctlvslsveheeaqllggvravvmdsqyli
    epcgsgksrlthicridlkghspewyskgfghlcaaevarirnsfqpliaegpetki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psoA (A:)
    tylnhliqglqkeakekfkgwvtcsstdntdlafkkvgdgnplklwkasveveappsvvl
    nrvlrerhlwdedfvqwkvvetldrqteiyqyvlnsmaphpsrdfvvlrtwktdlpkgmc
    tlvslsveheeaqllggvravvmdsqyliepcgsgksrlthicridlkghspewyskgfg
    hlcaaevarirnsfqpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2psoB (B:)
    mhhhhhhssgvdlgtenlyfqsmeesgatfhtylnhliqglqkeakekfkgwvtcsstdn
    tdlafkkvgdgnplklwkasveveappsvvlnrvlrerhlwdedfvqwkvvetldrqtei
    yqyvlnsmaphpsrdfvvlrtwktdlpkgmctlvslsveheeaqllggvravvmdsqyli
    epcgsgksrlthicridlkghspewyskgfghlcaaevarirnsfqpliaegpetki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psoB (B:)
    htylnhliqglqkeakekfkgwvtcsstdntdlafkkvgdgnplklwkasveveappsvv
    lnrvlrerhlwdedfvqwkvvetldrqteiyqyvlnsmaphpsrdfvvlrtwktdlpkgm
    ctlvslsveheeaqllggvravvmdsqyliepcgsgksrlthicridlkghspewyskgf
    ghlcaaevarirnsfqpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2psoC (C:)
    mhhhhhhssgvdlgtenlyfqsmeesgatfhtylnhliqglqkeakekfkgwvtcsstdn
    tdlafkkvgdgnplklwkasveveappsvvlnrvlrerhlwdedfvqwkvvetldrqtei
    yqyvlnsmaphpsrdfvvlrtwktdlpkgmctlvslsveheeaqllggvravvmdsqyli
    epcgsgksrlthicridlkghspewyskgfghlcaaevarirnsfqpliaegpetki
    

    Sequence, based on observed residues (ATOM records): (download)
    >2psoC (C:)
    ylnhliqglqkeakekfkgwvtcsstdntdlafkkvgdgnplklwkasveveappsvvln
    rvlrerhlwdedfvqwkvvetldrqteiyqyvlnsmaphpsrdfvvlrtwktdlpkgmct
    lvslsveheeaqllggvravvmdsqyliesrlthicridlkghspewyskgfghlcaaev
    arirnsfq