PDB entry 2psg

View 2psg on RCSB PDB site
Description: refined structure of porcine pepsinogen at 1.8 angstroms resolution
Class: hydrolase(acid proteinase zymogen)
Keywords: hydrolase(acid proteinase zymogen)
Deposited on 1991-01-23, released 1992-10-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepsinogen
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00791 (44-369)
      • conflict (62)
      • conflict (306)
    Domains in SCOPe 2.05: d2psga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2psgA (A:)
    lvkvplvrkkslrqnlikdgklkdflkthkhnpaskyfpeaaaligdeplenyldteyfg
    tigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpddsstfeatsqelsityg
    tgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgilglaypsisasgatpv
    fdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgslnwvpvsvegywqitlds
    itmdgetiacsggcqaivdtgtslltgptsaianiqsdigasensdgemviscssidslp
    divftidgvqyplspsayilqdddsctsgfegmdvptssgelwilgdvfirqyytvfdra
    nnkvglapva