PDB entry 2pru

View 2pru on RCSB PDB site
Description: NMR Structure of Human apoS100B at 10C
Class: metal binding protein
Keywords: S100, Calcium Binding Protein, EF-hand, all alpha helical protein, METAL BINDING PROTEIN
Deposited on 2007-05-04, released 2008-04-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein S100-B
  Species: Homo sapiens [TaxId:9606]
  Gene: S100B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04271 (0-90)
  Domains in SCOPe 2.01: d2prua1
• Chain 'B':
  Compound: Protein S100-B
  Species: Homo sapiens [TaxId:9606]
  Gene: S100B
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04271 (0-90)
  Domains in SCOPe 2.01: d2prub1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pruA (A:)
  selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
  dndgdgecdfqefmafvamvttacheffehe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pruB (B:)
  selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
  dndgdgecdfqefmafvamvttacheffehe