PDB entry 2prr

View 2prr on RCSB PDB site
Description: Crystal structure of alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein (YP_296737.1) from Ralstonia eutropha JMP134 at 2.15 A resolution
Class: oxidoreductase
Keywords: YP_296737.1, Carboxymuconolactone decarboxylase family, Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, OXIDOREDUCTASE
Deposited on 2007-05-04, released 2007-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prra1
  • Chain 'B':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrb_
  • Chain 'C':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrc_
  • Chain 'D':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrd_
  • Chain 'E':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prre_
  • Chain 'F':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrf_
  • Chain 'G':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrg_
  • Chain 'H':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrh_
  • Chain 'I':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prri_
  • Chain 'J':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrj_
  • Chain 'K':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrk_
  • Chain 'L':
    Compound: Alkylhydroperoxidase AhpD core: uncharacterized peroxidase-related protein
    Species: Cupriavidus necator [TaxId:264198]
    Gene: YP_296737.1, Reut_A2532
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46Y90
      • modified residue (62)
      • modified residue (75)
      • modified residue (126)
      • modified residue (174)
      • modified residue (180)
      • modified residue (189)
    Domains in SCOPe 2.07: d2prrl_
  • Heterogens: PEG, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2prrA (A:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrA (A:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2prrB (B:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrB (B:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2prrC (C:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrC (C:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2prrD (D:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrD (D:)
    rpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalm
    lkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadippr
    qramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrp
    ndefflmgrvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2prrE (E:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrE (E:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvpk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2prrF (F:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrF (F:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvpk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2prrG (G:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrG (G:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2prrH (H:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrH (H:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvpk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2prrI (I:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrI (I:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2prrJ (J:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrJ (J:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2prrK (K:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrK (K:)
    rpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalm
    lkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadippr
    qramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrp
    ndefflmgrvp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2prrL (L:)
    gmtrpahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhd
    almlkdggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadi
    pprqramldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantig
    mrpndefflmgrvpksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2prrL (L:)
    ahpisrypvpelaalpddirqrilevqdkagfvpnvfltlahrpdefraffayhdalmlk
    dggltkgeremivvatsaanqclycvvahgailriyekkplvadqvavnylkadipprqr
    amldfalkvckashevneadfealrehgftdedawdiaaitaffglsnrmantigmrpnd
    efflmgrvp