PDB entry 2prn

View 2prn on RCSB PDB site
Description: rhodopseudomonas blastica porin, triple mutant e1m, e99w, a116w
Class: integral membrane protein
Keywords: integral membrane protein, porin, pore eyelet mutant
Deposited on 1998-06-12, released 1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: porin
    Species: Rhodobacter blasticus [TaxId:1075]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39767 (1-288)
      • engineered mutation (98)
      • engineered mutation (115)
    Domains in SCOPe 2.06: d2prna_
  • Heterogens: MG, C8E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2prnA (A:)
    mislngygrfglqyvedrgvgledtiissrlrinivgttetdqgvtfgaklrmqwddgda
    fagtagnaaqfwtsyngvtvsvgnvdtafdsvaltydswmgyeassfgdaqssffwynsk
    ydasgaldnyngiavtysisgvnlylsyvdpdqtvdsslvteefgiaadwsndmislaaa
    yttdaggivdndiafvgaaykfndagtvglnwydnglstagdqvtlygnyafgattvray
    vsdidragadtaygigadyqfaegvkvsgsvqsgfanetvadvgvrfdf