PDB entry 2prd

View 2prd on RCSB PDB site
Description: crystal structure of inorganic pyrophosphatase from thermus thermophilus
Class: hydrolase
Keywords: hydrolase
Deposited on 1993-12-21, released 1995-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrophosphate phosphohydrolase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2prda_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2prdA (A:)
    anlkslpvgdkapevvhmvievprgsgnkyeydpdlgaikldrvlpgaqfypgdygfips
    tlaedgdpldglvlstypllpgvvvevrvvglllmedekggdakvigvvaedqrldhiqd
    igdvpegvkqeiqhffetykaleakkgkwvkvtgwrdrkaaleevraciarykg