PDB entry 2pqu

View 2pqu on RCSB PDB site
Description: Crystal structure of KH1 domain of human PCBP2 complexed to single-stranded 12-mer telomeric dna
Class: RNA AND DNA Binding protein/DNA
Keywords: DNA Binding Protein-DNA complex
Deposited on 2007-05-02, released 2007-06-12
The last revision prior to the SCOP 1.75 freeze date was dated 2007-07-10, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.218
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366 (1-End)
      • cloning artifact (0)
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.75: d2pqua1
  • Chain 'B':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.75: d2pqub1
  • Chain 'C':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.75: d2pquc1
  • Chain 'D':
    Compound: Poly(rC)-binding protein 2
    Species: HOMO SAPIENS
    Gene: PCBP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15366
      • modified residue (10)
      • modified residue (29)
      • modified residue (64)
    Domains in SCOP 1.75: d2pqud1
  • Chain 'E':
    Compound: 12-mer C-rich strand of human telomeric DNA
  • Chain 'G':
    Compound: 12-mer C-rich strand of human telomeric DNA
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pquA (A:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pquA (A:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidklee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pquB (B:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pquB (B:)
    vtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifka
    famiidklee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pquC (C:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pquC (C:)
    vtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifka
    famiidklee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pquD (D:)
    knvtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaif
    kafamiidkleed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pquD (D:)
    vtltirllmhgkevgsiigkkgesvkkmreesgarinisegncperiitlagptnaifka
    famiidklee
    

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    No sequence available.