PDB entry 2pqo

View 2pqo on RCSB PDB site
Description: Crystal structure of human HDAC7 in complex with SAHA
Class: hydrolase
Keywords: HDAC, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2007-05-02, released 2007-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-02-19, with a file datestamp of 2008-02-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.182
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone deacetylase 7a
    Species: HOMO SAPIENS
    Gene: HDAC7A, HDAC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pqoa_
  • Chain 'B':
    Compound: Histone deacetylase 7a
    Species: HOMO SAPIENS
    Gene: HDAC7A, HDAC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pqob_
  • Chain 'C':
    Compound: Histone deacetylase 7a
    Species: HOMO SAPIENS
    Gene: HDAC7A, HDAC7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pqoc_
  • Heterogens: ZN, K, SHH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pqoA (A:)
    raqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsrhp
    ehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkldng
    klagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkngfa
    vvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyqdp
    svlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafrivv
    mpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlalegg
    hdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqrla
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pqoA (A:)
    tlpfttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkasl
    eelqsvhserhvllygtnplsrlkldngklagllaqrmfvmlpcggvgvdtdtiwnelhs
    snaarwaagsvtdlafkvasrelkngfavvrppghhadhstamgfcffnsvaiacrqlqq
    qskaskilivdwdvhhgngtqqtfyqdpsvlyislhrhddgnffpgsgavdevgagsgeg
    fnvnvawaggldppmgdpeylaafrivvmpiarefspdlvlvsagfdaaeghpaplggyh
    vsakcfgymtqqlmnlaggavvlalegghdltaicdaseacvaallgnrvdplseegwkq
    kpnlnairsleavirvhskywgcmqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pqoB (B:)
    raqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsrhp
    ehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkldng
    klagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkngfa
    vvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyqdp
    svlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafrivv
    mpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlalegg
    hdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqrla
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pqoB (B:)
    lpfttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkasle
    elqsvhserhvllygtnplsvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkva
    srelkngfavvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgng
    tqqtfyqdpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpe
    ylaafrivvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlagg
    avvlalegghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhsk
    ywgcmqrl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pqoC (C:)
    raqsspaapaslsapepasqarvlsssetpartlpfttgliydsvmlkhqcscgdnsrhp
    ehagriqsiwsrlqerglrsqceclrgrkasleelqsvhserhvllygtnplsrlkldng
    klagllaqrmfvmlpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkngfa
    vvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyqdp
    svlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafrivv
    mpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlalegg
    hdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmqrla
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pqoC (C:)
    ttgliydsvmlkhqcscgdnsrhpehagriqsiwsrlqerglrsqceclrgrkasleelq
    svhserhvllygtnplpcggvgvdtdtiwnelhssnaarwaagsvtdlafkvasrelkng
    favvrppghhadhstamgfcffnsvaiacrqlqqqskaskilivdwdvhhgngtqqtfyq
    dpsvlyislhrhddgnffpgsgavdevgagsgegfnvnvawaggldppmgdpeylaafri
    vvmpiarefspdlvlvsagfdaaeghpaplggyhvsakcfgymtqqlmnlaggavvlale
    gghdltaicdaseacvaallgnrvdplseegwkqkpnlnairsleavirvhskywgcmq