PDB entry 2pqn

View 2pqn on RCSB PDB site
Description: Crystal structure of yeast Fis1 complexed with a fragment of yeast Mdv1
Class: apoptosis
Keywords: TPR domain, protein-protein complex, APOPTOSIS
Deposited on 2007-05-02, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondria fission 1 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: FIS1, MDV2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pqna_
  • Chain 'B':
    Compound: Mitochondrial division protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MDV1, FIS2, GAG3, NET2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pqnA (A:)
    mtkvdfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderl
    gvkiltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmv
    edkiqketl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pqnA (A:)
    vdfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderlgvk
    iltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmvedk
    iqketl
    

  • Chain 'B':
    No sequence available.