PDB entry 2pqe

View 2pqe on RCSB PDB site
Description: Solution structure of proline-free mutant of staphylococcal nuclease
Class: hydrolase
Keywords: beta barrel, OB fold, HYDROLASE
Deposited on 2007-05-01, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI6 (0-148)
      • engineered (10)
      • engineered (30)
      • engineered (41)
      • engineered (46)
      • engineered (55)
      • engineered (116)
    Domains in SCOPe 2.06: d2pqea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pqeA (A:)
    atstkklhkeaatlikaidgdtvklmykgqamtfrlllvdtaetkhtkkgvekygaeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnnt
    heqllrkseaqakkeklniwsednadsgq