PDB entry 2pq2

View 2pq2 on RCSB PDB site
Description: Structure of serine proteinase K complex with a highly flexible hydrophobic peptide at 1.8A resolution
Class: hydrolase
Keywords: proteinase k, hydrophobic peptide galag, complex, crystal structure, hydrolase
Deposited on 2007-05-01, released 2007-05-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.17
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteinase K
    Species: Engyodontium album [TaxId:37998]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06873 (0-278)
      • engineered (206)
    Domains in SCOPe 2.01: d2pq2a_
  • Chain 'B':
    Compound: GALAG peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2PQ2 (0-4)
  • Heterogens: CA, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pq2A (A:)
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

  • Chain 'B':
    No sequence available.