PDB entry 2pq0

View 2pq0 on RCSB PDB site
Description: Crystal structure of Hyopthetical protein (gk_1056) from geobacillus Kaustophilus HTA426
Class: structural genomics, unknown function
Keywords: HYOPTHETICAL PROTEIN, STRUCTURAL GENOMICS, UNKNOWN FUNCTION, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-05-01, released 2008-05-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.208
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical conserved protein GK1056
    Species: Geobacillus kaustophilus [TaxId:235909]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pq0a_
  • Chain 'B':
    Compound: Hypothetical conserved protein GK1056
    Species: Geobacillus kaustophilus [TaxId:235909]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pq0b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pq0A (A:)
    mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
    sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
    vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
    ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
    pvdkegiwyglkqlqlir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pq0A (A:)
    grkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgids
    fvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphihv
    smaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpag
    gskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtkp
    vdkegiwyglkqlqli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pq0B (B:)
    mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
    sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
    vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
    ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
    pvdkegiwyglkqlqlir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pq0B (B:)
    mgrkivffdidgtlldeqkqlplstieavrrlkqsgvyvaiatgrapfmfehvrkqlgid
    sfvsfngqyvvfegnvlykqplrrekvralteeahknghplvfmdaekmrasigdhphih
    vsmaslkfahppvdplyyenkdiyqallfcraeeeepyvrnypefrfvrwhdvstdvlpa
    ggskaegirmmieklgidkkdvyafgdglndiemlsfvgtgvamgnaheevkrvadfvtk
    pvdkegiwyglkqlqli