PDB entry 2ppx

View 2ppx on RCSB PDB site
Description: Crystal structure of a HTH XRE-family like protein from Agrobacterium tumefaciens
Class: structural genomics, unknown function
Keywords: Agrobacterium tumefaciens, HTH-motif, XRE-family, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2007-04-30, released 2007-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Atu1735
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: Atu1735, AGR_C_3184
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UEM2
      • modified residue (31)
    Domains in SCOPe 2.08: d2ppxa1
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ppxA (A:)
    ghmtdedseanaladpdnpplsaeqlasaprmprikiirralkltqeefsaryhiplgtl
    rdweqgrsepdqparaylkiiavdpegtaaalrkgatgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppxA (A:)
    mprikiirralkltqeefsaryhiplgtlrdweqgrsepdqparaylkiiavdpegtaaa
    lr