PDB entry 2ppq

View 2ppq on RCSB PDB site
Description: Crystal structure of the homoserine kinase from Agrobacterium tumefaciens
Class: transferase
Keywords: homoserine kinase, structural genomics, MCSG, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, TRANSFERASE
Deposited on 2007-04-30, released 2007-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.19
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: homoserine kinase
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: thrB, Atu0775, AGR_C_1416
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UHA8
      • modified residue (68)
      • modified residue (107)
      • modified residue (127)
    Domains in SCOPe 2.07: d2ppqa1
  • Heterogens: MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ppqA (A:)
    mavytditedelrnfltqydvgsltsykgiaegvensnfllhttkdpliltlyekrvekn
    dlpfflglmqhlaakglscplplprkdgellgelsgrpaalisflegmwlrkpeakhcre
    vgkalaamhlasegfeikrpnalsvdgwkvlwdkseeradevekglreeirpeidylaah
    wpkdlpagvihadlfqdnvfflgdelsglidfyfacndllaydvsiclnawcfekdgayn
    vtkgkallegyqsvrplseaelealpllsrgsalrffltrlydwlttpagalvvkkdple
    ylrklrfhrtianvaeyglage
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppqA (A:)
    tditedelrnfltqydvgsltsykgiaensnfllhttkdpliltlyekkndlpfflglmq
    hlaakglscplplprkdgellgelsgrpaalisflegmwlrkpeakhcrevgkalaamhl
    asegfeikrpnalsvdgwkvlwdkseeradevekglreeirpeidylaahwpkdlpagvi
    hadlfqdnvfflgdelsglidfyfacndllaydvsiclnawcfekdgaynvtkgkalleg
    yqsvrplseaelealpllsrgsalrffltrlydwlttpagalvvkkdpleylrklrfhrt
    ianvaeygla