PDB entry 2ppp

View 2ppp on RCSB PDB site
Description: Crystal structure of E60Q mutant of FKBP12
Class: lyase
Keywords: high resolution protein structure, lyase
Deposited on 2007-04-30, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: N/A
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein 1A
    Species: HOMO SAPIENS
    Gene: FKBP1A, FKBP1, FKBP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (59)
    Domains in SCOPe 2.08: d2pppa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pppA (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwq
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle