PDB entry 2ppn

View 2ppn on RCSB PDB site
Description: Crystal structure of FKBP12
Class: isomerase
Keywords: high resolution protein structure, ISOMERASE
Deposited on 2007-04-30, released 2008-05-27
The last revision prior to the SCOP 1.75 freeze date was dated 2008-05-27, with a file datestamp of 2008-05-23.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.213
AEROSPACI score: 1.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FK506-binding protein 1A
  Species: HOMO SAPIENS
  Gene: FKBP1A, FKBP1, FKBP12
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
  Domains in SCOP 1.75: d2ppna1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ppnA (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle