PDB entry 2pp4

View 2pp4 on RCSB PDB site
Description: Solution Structure of ETO-TAFH refined in explicit solvent
Class: transcription
Keywords: transcriptional cofactor, Leukemia, 4-helix bundle
Deposited on 2007-04-27, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ETO
    Species: Homo sapiens [TaxId:9606]
    Gene: RUNX1T1, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06455 (0-106)
      • engineered (17)
    Domains in SCOPe 2.08: d2pp4a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pp4A (A:)
    garqlsklkrflttlqqygndispeigervrtlvlglvnstltieefhsklqeatnfplr
    pfvipflkanlpllqrellhcarlakqnpaqylaqheqllldastts