PDB entry 2poz

View 2poz on RCSB PDB site
Description: Crystal structure of a putative dehydratase from Mesorhizobium loti
Class: structural genomics, unknown function
Keywords: 9283a, putative dehydratase, octamer, Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2007-04-27, released 2007-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative dehydratase
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll9372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981H6 (3-383)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (74)
      • modified residue (176)
      • modified residue (202)
      • modified residue (287)
      • modified residue (295)
      • modified residue (301)
      • modified residue (328)
      • modified residue (359)
    Domains in SCOPe 2.06: d2poza1, d2poza2, d2poza3
  • Chain 'B':
    Compound: Putative dehydratase
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll9372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981H6 (3-383)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (74)
      • modified residue (176)
      • modified residue (202)
      • modified residue (287)
      • modified residue (295)
      • modified residue (301)
      • modified residue (328)
      • modified residue (359)
    Domains in SCOPe 2.06: d2pozb1, d2pozb2, d2pozb3
  • Chain 'C':
    Compound: Putative dehydratase
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll9372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981H6 (3-383)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (74)
      • modified residue (176)
      • modified residue (202)
      • modified residue (287)
      • modified residue (295)
      • modified residue (301)
      • modified residue (328)
      • modified residue (359)
    Domains in SCOPe 2.06: d2pozc1, d2pozc2, d2pozc3
  • Chain 'D':
    Compound: Putative dehydratase
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll9372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981H6 (3-383)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (74)
      • modified residue (176)
      • modified residue (202)
      • modified residue (287)
      • modified residue (295)
      • modified residue (301)
      • modified residue (328)
      • modified residue (359)
    Domains in SCOPe 2.06: d2pozd1, d2pozd2, d2pozd3
  • Chain 'E':
    Compound: Putative dehydratase
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll9372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981H6 (3-383)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (74)
      • modified residue (176)
      • modified residue (202)
      • modified residue (287)
      • modified residue (295)
      • modified residue (301)
      • modified residue (328)
      • modified residue (359)
    Domains in SCOPe 2.06: d2poze1, d2poze2, d2poze3
  • Chain 'F':
    Compound: Putative dehydratase
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll9372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981H6 (3-383)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (74)
      • modified residue (176)
      • modified residue (202)
      • modified residue (287)
      • modified residue (295)
      • modified residue (301)
      • modified residue (328)
      • modified residue (359)
    Domains in SCOPe 2.06: d2pozf1, d2pozf2, d2pozf3
  • Chain 'G':
    Compound: Putative dehydratase
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll9372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981H6 (3-383)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (74)
      • modified residue (176)
      • modified residue (202)
      • modified residue (287)
      • modified residue (295)
      • modified residue (301)
      • modified residue (328)
      • modified residue (359)
    Domains in SCOPe 2.06: d2pozg1, d2pozg2, d2pozg3
  • Chain 'H':
    Compound: Putative dehydratase
    Species: Mesorhizobium loti [TaxId:266835]
    Gene: mll9372
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q981H6 (3-383)
      • cloning artifact (2)
      • modified residue (50)
      • modified residue (74)
      • modified residue (176)
      • modified residue (202)
      • modified residue (287)
      • modified residue (295)
      • modified residue (301)
      • modified residue (328)
      • modified residue (359)
    Domains in SCOPe 2.06: d2pozh1, d2pozh2, d2pozh3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pozA (A:)
    mslkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfl
    igkdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggki
    rdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsae
    aielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdng
    alkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeay
    nmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfem
    pngpglgavlikrniepylwascteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pozA (A:)
    lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
    kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkird
    rvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsaeai
    elayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngal
    kviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynm
    rvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempn
    gpglgavlikrniepylwasct
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pozB (B:)
    mslkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfl
    igkdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggki
    rdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsae
    aielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdng
    alkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeay
    nmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfem
    pngpglgavlikrniepylwascteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pozB (B:)
    lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
    kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkird
    rvrayangwygaadtpdefaraverplkegygalkfyplaqlqhvtrrsmsaeaielayr
    rvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngalkvise
    qiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynmrvaph
    vcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempngpglg
    avlikrniepylwasct
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pozC (C:)
    mslkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfl
    igkdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggki
    rdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsae
    aielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdng
    alkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeay
    nmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfem
    pngpglgavlikrniepylwascteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pozC (C:)
    lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
    kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkird
    rvrayangwygaadtpdefaraverplkegygalkfyplalqhvtrrsmsaeaielayrr
    vkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngalkviseq
    iplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynmrvaphv
    cgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempngpglga
    vlikrniepylwasct
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pozD (D:)
    mslkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfl
    igkdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggki
    rdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsae
    aielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdng
    alkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeay
    nmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfem
    pngpglgavlikrniepylwascteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pozD (D:)
    lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
    kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkird
    rvrayangwygaadtpdefaraverplkegygalkfyplaqlqhvtrrsmsaeaielayr
    rvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngalkvise
    qiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynmrvaph
    vcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempngpglg
    avlikrniepylwasct
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pozE (E:)
    mslkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfl
    igkdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggki
    rdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsae
    aielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdng
    alkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeay
    nmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfem
    pngpglgavlikrniepylwascteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pozE (E:)
    lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
    kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkird
    rvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsaeai
    elayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngal
    kviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynm
    rvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempn
    gpglgavlikrniepylwasct
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pozF (F:)
    mslkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfl
    igkdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggki
    rdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsae
    aielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdng
    alkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeay
    nmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfem
    pngpglgavlikrniepylwascteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pozF (F:)
    lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
    kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkird
    rvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsaeai
    elayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngal
    kviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynm
    rvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempn
    gpglgavlikrniepylwasct
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2pozG (G:)
    mslkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfl
    igkdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggki
    rdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsae
    aielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdng
    alkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeay
    nmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfem
    pngpglgavlikrniepylwascteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pozG (G:)
    lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
    kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkird
    rvrayangwygaadtpdefaraverplkegygalkfyplaqlqhvtrrsmsaeaielayr
    rvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngalkvise
    qiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynmrvaph
    vcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempngpglg
    avlikrniepylwasct
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2pozH (H:)
    mslkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfl
    igkdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggki
    rdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsmsae
    aielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdng
    alkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeay
    nmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfem
    pngpglgavlikrniepylwascteghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pozH (H:)
    lkitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserflig
    kdpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfggkird
    rvrayangwygaadtpdefaraverplkegygalkfyplaqrvlqhvtrrsmsaeaiela
    yrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfdngalkvi
    seqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamaeaynmrva
    phvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyfempngpg
    lgavlikrniepylwasct