PDB entry 2pox

View 2pox on RCSB PDB site
Description: Dark state structure of the reversibly switchable fluorescent protein Dronpa
Class: fluorescent protein
Keywords: Luminescent protein; reversibly switchable fluorescent protein; green-fluorescent protein-like protein, FLUORESCENT PROTEIN
Deposited on 2007-04-27, released 2007-07-17
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.176
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (33-End)
      • expression tag (30-32)
      • chromophore (94)
    Domains in SCOPe 2.03: d2poxa_
  • Chain 'B':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (33-End)
      • expression tag (30-32)
      • chromophore (94)
    Domains in SCOPe 2.03: d2poxb_
  • Chain 'C':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6 (33-End)
      • chromophore (94)
    Domains in SCOPe 2.03: d2poxc_
  • Chain 'D':
    Compound: Fluorescent protein Dronpa
    Species: Echinophyllia sp. SC22 [TaxId:301887]
    Gene: Dronpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5TLG6
      • chromophore (94)
    Domains in SCOPe 2.03: d2poxd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2poxA (A:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2poxA (A:)
    kdpmsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydil
    ttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiye
    irfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfktty
    kakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2poxB (B:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2poxB (B:)
    kdpmsvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydil
    ttvfcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiye
    irfdgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfktty
    kakkvvqlpdyhfvdhhieikshdkdysnvnlhehaeahsel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2poxC (C:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2poxC (C:)
    msvikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttv
    fcygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirf
    dgvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykak
    kvvqlpdyhfvdhhieikshdkdysnvnlhehaeahse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2poxD (D:)
    mrgshhhhhhgmasmtggqqmgrdlyddddkdpmsvikpdmkiklrmegavnghpfaieg
    vglgkpfegkqsmdlkvkeggplpfaydilttvfcygnrvfakypenivdyfkqsfpegy
    swersmnyedggicnatnditldgdcyiyeirfdgvnfpangpvmqkrtvkwepstekly
    vrdgvlkgdvnmalsleggghyrcdfkttykakkvvqlpdyhfvdhhieikshdkdysnv
    nlhehaeahselprqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >2poxD (D:)
    svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
    cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
    gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
    vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse