PDB entry 2pon

View 2pon on RCSB PDB site
Description: Solution structure of the Bcl-xL/Beclin-1 complex
Class: apoptosis inhibitor
Keywords: Apoptosis; Autophagy; Bcl-2 family proteins; Beclin-1, APOPTOSIS INHIBITOR
Deposited on 2007-04-27, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beclin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: BECN1, GT197
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: apoptosis regulator bcl-x
    Species: Homo sapiens [TaxId:9606]
    Gene: BCL2L1, BCL2L, BCLX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2ponb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ponB (B:)
    msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
    yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
    vlvsriaawmatylndhlepwiqenggwdtfvelyg