PDB entry 2pon

View 2pon on RCSB PDB site
Description: Solution structure of the Bcl-xL/Beclin-1 complex
Class: apoptosis inhibitor
Keywords: Apoptosis; Autophagy; Bcl-2 family proteins; Beclin-1, APOPTOSIS INHIBITOR
Deposited on 2007-04-27, released 2007-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beclin-1
  Species: Homo sapiens [TaxId:9606]
  Gene: BECN1, GT197
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14457 (0-22)
• Chain 'B':
  Compound: apoptosis regulator bcl-x
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL2L1, BCL2L, BCLX
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07817 (0-43)
  • Uniprot Q07817 (44-155)
  Domains in SCOPe 2.08: d2ponb_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2ponB (B:)
  msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
  yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
  vlvsriaawmatylndhlepwiqenggwdtfvelyg