PDB entry 2pol

View 2pol on RCSB PDB site
Description: three-dimensional structure of the beta subunit of escherichia coli dna polymerase iii holoenzyme: a sliding dna clamp
Deposited on 1992-11-13, released 1994-01-31
The last revision prior to the SCOP 1.67 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2polA (A:)
    mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
    qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
    dwqseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavc
    smpigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgr
    fpdyrrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqe
    eaeeildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayv
    vmpmrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2polB (B:)
    mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememvarvalv
    qphepgattvparkffdicrglpegaeiavqlegermlvrsgrsrfslstlpaadfpnld
    dwqseveftlpqatmkrlieatqfsmahqdvryylngmlfetegeelrtvatdghrlavc
    smpigqslpshsvivprkgvielmrmldggdnplrvqigsnnirahvgdfiftsklvdgr
    fpdyrrvlpknpdkhleagcdllkqafaraailsnekfrgvrlyvsenqlkitannpeqe
    eaeeildvtysgaemeigfnvsyvldvlnalkcenvrmmltdsvssvqiedaasqsaayv
    vmpmrl