PDB entry 2poj

View 2poj on RCSB PDB site
Description: NMR Solution Structure of the Inhibitor-Free State of Macrophage Metalloelastase (MMP-12)
Class: Hydrolase
Keywords: INHIBITOR-FREE SOLUTION STRUCTURE, MATRIX METALOPROTEINASE, MACROPHAGE METALLOELASTASE, MMP-12, Hydrolase
Deposited on 2007-04-26, released 2007-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (0-163)
      • engineered (119)
    Domains in SCOPe 2.06: d2poja_
  • Heterogens: ZN, CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pojA (A:)
    frempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadi
    lvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavha
    ighslglghssdpkavmfptykyvdintfrlsaddirgiqslyg