PDB entry 2pnx

View 2pnx on RCSB PDB site
Description: The PHD finger of ING4 in complex with an H3K4Me3 histone peptide
Class: gene regulation
Keywords: protein-peptide complex, chromatin, zinc finger, histone, GENE REGULATION
Deposited on 2007-04-25, released 2008-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inhibitor of growth protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ING4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pnxa1
  • Chain 'B':
    Compound: H3K4Me3 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2PNX (0-End)
  • Chain 'C':
    Compound: Inhibitor of growth protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: ING4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pnxc1
  • Chain 'D':
    Compound: H3K4Me3 peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 2PNX (0-End)
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2pnxA (A:)
gsneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer

    Sequence, based on observed residues (ATOM records): (download) 
    >2pnxA (A:)
eptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqe

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >2pnxC (C:)
gsneptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsqer

    Sequence, based on observed residues (ATOM records): (download) 
    >2pnxC (C:)
neptyclchqvsygemigcdnpdcsiewfhfacvglttkprgkwfcprcsq

  • Chain 'D':
    No sequence available.