PDB entry 2pnr

View 2pnr on RCSB PDB site
Description: Crystal Structure of the asymmetric Pdk3-l2 Complex
Class: transferase
Keywords: pyruvate dehydrogenase kinase 3, lipoyl-bearing domain, asymmetric protein-protein complex, TRANSFERASE
Deposited on 2007-04-25, released 2007-08-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PDK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pnra1, d2pnra3
  • Chain 'B':
    Compound: [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PDK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pnrb1, d2pnrb2
  • Chain 'C':
    Compound: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
    Species: Homo sapiens [TaxId:9606]
    Gene: DLAT, DLTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pnrc_
  • Chain 'E':
    Compound: [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PDK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pnre1, d2pnre3
  • Chain 'F':
    Compound: [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PDK3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pnrf1, d2pnrf2
  • Chain 'G':
    Compound: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
    Species: Homo sapiens [TaxId:9606]
    Gene: DLAT, DLTA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pnrg_
  • Heterogens: RED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pnrA (A:)
    ggshhhhhhgmarlenlyfqgkqpvpkqierysrfspsplsikqfldfgrdnacektsym
    flrkelpvrlantmrevnllpdnllnrpsvglvqswymqsflelleyenkspedpqvldn
    flqvlikvrnrhndvvptmaqgvieykekfgfdpfistniqyfldrfytnrisfrmlinq
    htllfggdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnaka
    pdkpiqvvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisd
    lgggvplrkidrlfnymystaprpsleptraaplagfgyglpisrlyaryfqgdlklysm
    egvgtdaviylkalssesferlpvfnksawrhykttpeaddwsnpsseprdaskykakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnrA (A:)
    pkqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnll
    nrpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgvie
    ykekfgfdpfistniqyfldrfytnrisfrmlinqhtllfggdtnpvhpkhigsidptcn
    vadvvkdayetakmlceqyylvapeleveefnakapdkpiqvvyvpshlfhmlfelfkns
    mratvelyedrkegypavktlvtlgkedlsikisdlgggvplrkidrlfnyaaplagfgy
    glpisrlyaryfqgdlklysmegvgtdaviylkalssesferlpvfnksawrhykttpea
    ddwsnpsseprdas
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pnrB (B:)
    ggshhhhhhgmarlenlyfqgkqpvpkqierysrfspsplsikqfldfgrdnacektsym
    flrkelpvrlantmrevnllpdnllnrpsvglvqswymqsflelleyenkspedpqvldn
    flqvlikvrnrhndvvptmaqgvieykekfgfdpfistniqyfldrfytnrisfrmlinq
    htllfggdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnaka
    pdkpiqvvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisd
    lgggvplrkidrlfnymystaprpsleptraaplagfgyglpisrlyaryfqgdlklysm
    egvgtdaviylkalssesferlpvfnksawrhykttpeaddwsnpsseprdaskykakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnrB (B:)
    kqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnlln
    rpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgviey
    kekstniqyfldrfytnrisfrmlinqhtllfggdtnpvhpkhigsidptcnvadvvkda
    yetakmlceqyylvapeleveefnakapdkpiqvvyvpshlfhmlfelfknsmratvely
    edypavktlvtlgkedlsikisdlgggvplrkidrlfnymglpisrlyaryfqgdlklys
    megvgtdaviylkalssesferlpvfnksawrhyktaddws
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pnrC (C:)
    ggshhhhhhgmarlenlyfqgssypphmqvllpalsptmtmgtvqrwekkvgeklsegdl
    laeietdkatigfevqeegylakilvpegtrdvplgtplciivekeadisafadyrptev
    tdlkpqvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnrC (C:)
    vllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegylakilvpeg
    trdvplgtplciivekead
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pnrE (E:)
    ggshhhhhhgmarlenlyfqgkqpvpkqierysrfspsplsikqfldfgrdnacektsym
    flrkelpvrlantmrevnllpdnllnrpsvglvqswymqsflelleyenkspedpqvldn
    flqvlikvrnrhndvvptmaqgvieykekfgfdpfistniqyfldrfytnrisfrmlinq
    htllfggdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnaka
    pdkpiqvvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisd
    lgggvplrkidrlfnymystaprpsleptraaplagfgyglpisrlyaryfqgdlklysm
    egvgtdaviylkalssesferlpvfnksawrhykttpeaddwsnpsseprdaskykakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnrE (E:)
    pkqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnll
    nrpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgvie
    ykekfgfdpfistniqyfldrfytnrisfrmlinqhtllfggdtnpvhpkhigsidptcn
    vadvvkdayetakmlceqyylvapeleveefnakapdkpiqvvyvpshlfhmlfelfkns
    mratvelyedrkegypavktlvtlgkedlsikisdlgggvplrkidrlfnyaaplagfgy
    glpisrlyaryfqgdlklysmegvgtdaviylkalssesferlpvfnksawrhykttpea
    ddwsnpsseprdas
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pnrF (F:)
    ggshhhhhhgmarlenlyfqgkqpvpkqierysrfspsplsikqfldfgrdnacektsym
    flrkelpvrlantmrevnllpdnllnrpsvglvqswymqsflelleyenkspedpqvldn
    flqvlikvrnrhndvvptmaqgvieykekfgfdpfistniqyfldrfytnrisfrmlinq
    htllfggdtnpvhpkhigsidptcnvadvvkdayetakmlceqyylvapeleveefnaka
    pdkpiqvvyvpshlfhmlfelfknsmratvelyedrkegypavktlvtlgkedlsikisd
    lgggvplrkidrlfnymystaprpsleptraaplagfgyglpisrlyaryfqgdlklysm
    egvgtdaviylkalssesferlpvfnksawrhykttpeaddwsnpsseprdaskykakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnrF (F:)
    kqierysrfspsplsikqfldfgrdnacektsymflrkelpvrlantmrevnllpdnlln
    rpsvglvqswymqsflelleyenkspedpqvldnflqvlikvrnrhndvvptmaqgviey
    kekstniqyfldrfytnrisfrmlinqhtllfggdtnpvhpkhigsidptcnvadvvkda
    yetakmlceqyylvapeleveefnakapdkpiqvvyvpshlfhmlfelfknsmratvely
    edypavktlvtlgkedlsikisdlgggvplrkidrlfnymglpisrlyaryfqgdlklys
    megvgtdaviylkalssesferlpvfnksawrhyktaddws
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2pnrG (G:)
    ggshhhhhhgmarlenlyfqgssypphmqvllpalsptmtmgtvqrwekkvgeklsegdl
    laeietdkatigfevqeegylakilvpegtrdvplgtplciivekeadisafadyrptev
    tdlkpqvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnrG (G:)
    vllpalsptmtmgtvqrwekkvgeklsegdllaeietdkatigfevqeegylakilvpeg
    trdvplgtplciivekead