PDB entry 2pni

View 2pni on RCSB PDB site
Description: solution structure and ligand-binding site of the sh3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1993-07-19, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: NMR26
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pnia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pniA (A:)
gsmsaegyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqeakpeeigwlng
ynettgergdfpgtyveyigrkkisp