PDB entry 2png

View 2png on RCSB PDB site
Description: Type I rat fatty acid synthase acyl carrier protein (ACP) domain
Class: Transferase
Keywords: acyl carrier protein, helical bundle, fatty acid synthase, Transferase
Deposited on 2007-04-24, released 2007-06-05
The last revision prior to the SCOP 1.75 freeze date was dated 2008-01-22, with a file datestamp of 2008-01-18.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty acid synthase (EC 2.3.1.85)
    Species: Rattus norvegicus
    Gene: Fasn
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pnga1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pngA (A:)
gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
vrqltlrklqemsskagsdtelaapkskn