PDB entry 2png

View 2png on RCSB PDB site
Description: Type I rat fatty acid synthase acyl carrier protein (ACP) domain
Class: Transferase
Keywords: acyl carrier protein, helical bundle, fatty acid synthase, Transferase
Deposited on 2007-04-24, released 2007-06-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fatty acid synthase (EC 2.3.1.85)
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Fasn
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12785 (0-88)
  Domains in SCOPe 2.08: d2pnga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pngA (A:)
  gdgeaqrdlvkavahilgirdlaginldssladlgldslmgvevrqilerehdlvlpire
  vrqltlrklqemsskagsdtelaapkskn