PDB entry 2pnf

View 2pnf on RCSB PDB site
Description: Structure of Aquifex Aeolicus FabG 3-oxoacyl-(acyl-carrier protein) reductase
Class: oxidoreductase
Keywords: short chain oxidoreductase, Rossmann fold, OXIDOREDUCTASE
Deposited on 2007-04-24, released 2007-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: fabG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2pnfa_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier-protein] reductase
    Species: Aquifex aeolicus [TaxId:224324]
    Gene: fabG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2pnfb_
  • Heterogens: 1PE, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pnfA (A:)
    meiklqgkvslvtgstrgigraiaeklasagstviitgtsgerakavaeeiankygvkah
    gvemnllseesinkafeeiynlvdgidilvnnagitrdklflrmslldweevlkvnltgt
    flvtqnslrkmikqrwgrivnissvvgftgnvgqvnysttkagligftkslakelaprnv
    lvnavapgfietdmtavlseeikqkykeqiplgrfgspeevanvvlflcselasyitgev
    ihvnggmf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pnfB (B:)
    meiklqgkvslvtgstrgigraiaeklasagstviitgtsgerakavaeeiankygvkah
    gvemnllseesinkafeeiynlvdgidilvnnagitrdklflrmslldweevlkvnltgt
    flvtqnslrkmikqrwgrivnissvvgftgnvgqvnysttkagligftkslakelaprnv
    lvnavapgfietdmtavlseeikqkykeqiplgrfgspeevanvvlflcselasyitgev
    ihvnggmf