PDB entry 2pnb

View 2pnb on RCSB PDB site
Description: structure of an sh2 domain of the p85 alpha subunit of phosphatidylinositol-3-oh kinase
Class: signalling protein
Keywords: signalling protein
Deposited on 1992-06-30, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphatidylinositol 3-kinase p85-alpha subunit n-terminal sh2 domain
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2pnba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2pnbA (A:)
lqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnklikifhrd
gkygfsdpltfnsvvelinhyrneslaqynpkldvkllypvsky