PDB entry 2pn6

View 2pn6 on RCSB PDB site
Description: Crystal Structure of S32A of ST1022-Gln complex from Sulfolobus tokodaii
Class: transcription
Keywords: Transcriptional regulator, Lrp/AsnC family Gln binding, ST1022, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2007-04-23, released 2008-04-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-03-17, with a file datestamp of 2009-03-13.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: 0.207
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 150aa long hypothetical transcriptional regulator
  Species: Sulfolobus tokodaii [TaxId:111955]
  Gene: ST1022
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q972W6 (0-149)
    • engineered (31)
  Domains in SCOPe 2.05: d2pn6a1, d2pn6a2
• Heterogens: MG, GLN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pn6A (A:)
  mdeidlrilkilqynakysldeiareiripkatlsyrikklekdgvikgyyayinpasln
  ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
  ervmsipevertstqvvvkiikespnivif