PDB entry 2pmu

View 2pmu on RCSB PDB site
Description: Crystal structure of the DNA-binding domain of PhoP
Class: transcription regulation
Keywords: winged helix-tun-helx, TRANSCRIPTION REGULATION
Deposited on 2007-04-23, released 2008-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: response regulator PHOP
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: PHOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pmua_
  • Chain 'B':
    Compound: response regulator PHOP
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: PHOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pmub_
  • Chain 'C':
    Compound: response regulator PHOP
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: PHOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pmuc_
  • Chain 'D':
    Compound: response regulator PHOP
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: PHOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pmud_
  • Chain 'E':
    Compound: response regulator PHOP
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: PHOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pmue_
  • Chain 'F':
    Compound: response regulator PHOP
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: PHOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pmuf_
  • Heterogens: PO4, K, UNX, CL, GLY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pmuA (A:)
    gthmkeprnvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkil
    dhvwrydfggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlreprkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmuA (A:)
    vrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvwrydfg
    gdvnvvesyvsylrrkidtgekrllhtlrgvgyvlrep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pmuB (B:)
    gthmkeprnvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkil
    dhvwrydfggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlreprkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmuB (B:)
    keprnvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvw
    rydfggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlrep
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pmuC (C:)
    gthmkeprnvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkil
    dhvwrydfggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlreprkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmuC (C:)
    nvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvwvnvv
    esyvsylrrkidtgekrllhtlrgvgyvlrep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pmuD (D:)
    gthmkeprnvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkil
    dhvwrydfggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlreprkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmuD (D:)
    vrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvwrydfg
    vnvvesyvsylrrkidtgekrllhtlrgvgyvlrep
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pmuE (E:)
    gthmkeprnvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkil
    dhvwrydfggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlreprkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmuE (E:)
    keprnvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvw
    rydfggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlrep
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pmuF (F:)
    gthmkeprnvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkil
    dhvwrydfggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlreprkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmuF (F:)
    nvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvwdvnv
    vesyvsylrrkidtgekrllhtlrgvgyvlrep