PDB entry 2pms

View 2pms on RCSB PDB site
Description: Crystal structure of the complex of human lactoferrin N-lobe and lactoferrin-binding domain of pneumococcal surface protein A
Class: metal transport, hydrolase
Keywords: lactoferrin, pneumococcal surface protein A, protein-protein complex, METAL TRANSPORT, HYDROLASE
Deposited on 2007-04-23, released 2007-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactotransferrin
    Species: Homo sapiens [TaxId:9606]
    Gene: LTF, LF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EK51
      • conflict (122)
  • Chain 'B':
    Compound: lactotransferrin
    Species: Homo sapiens [TaxId:9606]
    Gene: LTF, LF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EK51
      • conflict (122)
  • Chain 'C':
    Compound: pneumococcal surface protein a (pspa)
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: pspA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DRI0 (4-124)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d2pmsc1, d2pmsc2
  • Chain 'D':
    Compound: pneumococcal surface protein a (pspa)
    Species: Streptococcus pneumoniae [TaxId:1313]
    Gene: pspA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DRI0 (4-124)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d2pmsd2, d2pmsd3
  • Heterogens: NAG, CO3, FE, SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pmsC (C:)
    gshmdaeevapqakiaelenqvhrleqelkeidesesedyakegfraplqskldakkakl
    skleelsdkideldaeiakledqlkaaeennnvedyfkeglektiaakkaelekteadlk
    kavne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmsC (C:)
    gshmdaeevapqakiaelenqvhrleqelkeideaplqskldakkaklskleelsdkide
    ldaeiakledqlkaaeeedyfkeglektiaakkaelekteadlkkavne
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pmsD (D:)
    gshmdaeevapqakiaelenqvhrleqelkeidesesedyakegfraplqskldakkakl
    skleelsdkideldaeiakledqlkaaeennnvedyfkeglektiaakkaelekteadlk
    kavne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmsD (D:)
    gshmdaeevapqakiaelenqvhrleqelkeideaplqskldakkaklskleelsdkide
    ldaeiakledqlkaaeeedyfkeglektiaakkaelekteadlkkavne