PDB entry 2pmr

View 2pmr on RCSB PDB site
Description: Crystal structure of a protein of unknown function from Methanobacterium thermoautotrophicum
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2007-04-23, released 2007-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: 0.175
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: MTH1690
    Database cross-references and differences (RAF-indexed):
    • Uniprot O27725 (Start-78)
      • cloning artifact (79)
    Domains in SCOPe 2.06: d2pmra1, d2pmra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pmrA (A:)
    msldcreriekdlelleknlmemksiklsddeeavveralnyrddsvyylekgdhitsfg
    cityahglldslrmlhriieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmrA (A:)
    creriekdlelleknlmemksiklsddeeavveralnyrddsvyylekgdhitsfgcity
    ahglldslrmlhriie