PDB entry 2pmh

View 2pmh on RCSB PDB site
Description: Crystal structure of Thr132Ala of ST1022 from Sulfolobus tokodaii
Class: Transcription regulator
Keywords: Transcriptional regulator, Lrp/AsnC family Gln binding, ST1022, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Transcription regulator
Deposited on 2007-04-22, released 2008-04-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.242
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 150aa long hypothetical transcriptional regulator
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST1022
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q972W6 (0-149)
      • engineered (131)
    Domains in SCOPe 2.04: d2pmha1, d2pmha2
  • Heterogens: MG, NA, GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmhA (A:)
    mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln
    ldyivitsvkakygknyhvelgnklaqipgvwgvyfvlgdndfivmaryktreefmekfl
    ervmsipeverastqvvvkiikespnivif