PDB entry 2pmd

View 2pmd on RCSB PDB site
Description: The structures of aIF2gamma subunit from the archaeon Sulfolobus solfataricus in the GDP-bound form.
Class: translation
Keywords: aIF2, Initiation factor 2 gamma subunit, Initiation of the translation, nucleotide binding, GDPNP, GDP, pyrophosphate
Deposited on 2007-04-21, released 2007-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor 2 gamma subunit
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pmda1, d2pmda2, d2pmda3
  • Chain 'B':
    Compound: Translation initiation factor 2 gamma subunit
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: eif2g
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2pmdb1, d2pmdb2, d2pmdb3
  • Heterogens: GDP, GNP, PPV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pmdA (A:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmdA (A:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pmdB (B:)
    mawpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvce
    sckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaa
    nepfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpi
    ipvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggvigg
    siiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigty
    ldpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmls
    vgssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmdB (B:)
    awpkvqpevnigvvghvdhgkttlvqaitgiwtskhseelkrgmtiklgyaetnigvces
    ckkpeayvtepsckscgsddepkflrrisfidapghevlmatmlsgaalmdgailvvaan
    epfpqpqtrehfvalgiigvknliivqnkvdvvskeealsqyrqikqftkgtwaenvpii
    pvsalhkinidsliegieeyiktpyrdlsqkpvmlvirsfdvnkpgtqfnelkggviggs
    iiqglfkvdqeikvlpglrvekqgkvsyepiftkissirfgdeefkeakpgglvaigtyl
    dpsltkadnllgsiitladaevpvlwnirikynllervvgakemlkvdpiraketlmlsv
    gssttlgivtsvkkdeievelrrpvavwsnnirtvisrqiagrwrmigwglvei