PDB entry 2pmc

View 2pmc on RCSB PDB site
Description: Crystal Structure of CheY-Mg(2+) in Complex with CheZ(C15) Peptide solved from a P1 Crystal
Class: signaling protein
Keywords: chemotaxis, chey-chez peptide complex, signaling protein
Deposited on 2007-04-20, released 2008-01-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.213
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chemotaxis protein cheY
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: cheY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pmca_
  • Chain 'B':
    Compound: Chemotaxis protein cheY
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: cheY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pmcb_
  • Chain 'C':
    Compound: Chemotaxis protein cheY
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: cheY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pmcc_
  • Chain 'D':
    Compound: Chemotaxis protein cheY
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: cheY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2pmcd_
  • Chain 'E':
    Compound: Chemotaxis protein cheZ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Chemotaxis protein cheZ
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmcA (A:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
    nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmcB (B:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
    nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmcC (C:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
    nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmcD (D:)
    adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
    nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
    kifeklgm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.