PDB entry 2pmc

View 2pmc on RCSB PDB site
Description: Crystal Structure of CheY-Mg(2+) in Complex with CheZ(C15) Peptide solved from a P1 Crystal
Class: signaling protein
Keywords: chemotaxis, chey-chez peptide complex, signaling protein
Deposited on 2007-04-20, released 2008-01-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-12, with a file datestamp of 2008-02-08.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chemotaxis protein cheY
  Species: Salmonella typhimurium
  Gene: cheY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A2D5 (0-127)
  Domains in SCOP 1.75: d2pmca1
• Chain 'B':
  Compound: Chemotaxis protein cheY
  Species: Salmonella typhimurium
  Gene: cheY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A2D5 (0-127)
  Domains in SCOP 1.75: d2pmcb1
• Chain 'C':
  Compound: Chemotaxis protein cheY
  Species: Salmonella typhimurium
  Gene: cheY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A2D5 (0-127)
  Domains in SCOP 1.75: d2pmcc1
• Chain 'D':
  Compound: Chemotaxis protein cheY
  Species: Salmonella typhimurium
  Gene: cheY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A2D5 (0-127)
  Domains in SCOP 1.75: d2pmcd1
• Chain 'E':
  Compound: Chemotaxis protein cheZ
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07800 (Start-14)
• Chain 'F':
  Compound: Chemotaxis protein cheZ
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P07800 (Start-14)
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pmcA (A:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
  nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pmcB (B:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
  nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pmcC (C:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
  nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pmcD (D:)
  adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
  nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
  kifeklgm
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.