PDB entry 2plt

View 2plt on RCSB PDB site
Description: structure determination of plastocyanin from a crystal specimen with hemihedral twinning fraction of one-half
Deposited on 1993-05-06, released 1993-10-31
The last revision prior to the SCOP 1.61 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.168
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d2plt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2plt_ (-)
  datvklgadsgalefvpktltiksgetvnfvnnagfphnivfdedaipsgvnadaisrdd
  ylnapgetysvkltaageygyycephqgagmvgkiivq